PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00080238001
Common NameGSBRNA2T00080238001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SRS
Protein Properties Length: 336aa    MW: 36713.3 Da    PI: 7.19
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00080238001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702228.41.3e-701162662154
               DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstkl 91 
                          r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qlaa+ +k++++ ++++ ++  +      sal++ ++
  GSBRNA2T00080238001 116 RQGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLAALPAKRSREPSSDDDENGGQ-GGGGGSALACIRV 204
                          7899******************************************************999888777666666555.588999******* PP

               DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          ++a+s+  le ++lP+e+ss+avfrc+rvss+dd++ee+aYqt+v+igGhvfkGiLydqG+++
  GSBRNA2T00080238001 205 VNASSS-GLESNHLPPEISSPAVFRCIRVSSIDDDDEEYAYQTVVEIGGHVFKGILYDQGPSD 266
                          *99765.99999************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.3E-63119265IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27121163IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.6E-28216264IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MAGMFNLGGR DNNKQDHLHH HMDKDHNEDK SSNHLYLYKE EIYNNNNRGF EIWPSQHFQQ  60
QQQNHVAPPT NFLSFGMVPS GGSNNNDRSS NRSLYFNVVS DHERIRSSTG TFTVSRQGNM  120
NCQDCGNQAK KDCPHMRCRT CCKSRGFDCQ THVKSTWVPA AKRRERQAQL AALPAKRSRE  180
PSSDDDENGG QGGGGGSALA CIRVVNASSS GLESNHLPPE ISSPAVFRCI RVSSIDDDDE  240
EYAYQTVVEI GGHVFKGILY DQGPSDHPYS SSPAAAEACQ RHINLLASTA LASTSTTATN  300
NTKASIDPSS LYTPTAAPFS TCITTGTPFF PPPRS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00080238001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1895581e-168AC189558.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006P24, complete sequence.
GenBankGU2052681e-168GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013694159.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH71e-170SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLA0A078I3710.0A0A078I371_BRANA; BnaC07g15630D protein
STRINGAT1G19790.11e-168(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-151SHI-related sequence 7
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]